PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001888.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 371aa    MW: 41564.2 Da    PI: 5.2292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001888.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++q+G g+W+++++  g+ R++k+c++rw +yl
      Pbr001888.1 14 KGLWSPEEDEKLFNYITQFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding42.91.1e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++  G++ W+ Ia+ ++ gRt++++k++w++
      Pbr001888.1  67 RGMFSQQEEDLILSLHEVIGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.429965IPR017930Myb domain
SuperFamilySSF466897.86E-2912108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
CDDcd001671.77E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129418.43166116IPR017930Myb domain
PfamPF002497.3E-1367111IPR001005SANT/Myb domain
CDDcd001672.35E-970109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRNSCCLKQ KLRKGLWSPE EDEKLFNYIT QFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLILS LHEVIGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLMKQG  120
IDPTTHKPLT EEEQKEANNI DCSDLNESLP MPELPTMPIT MASQGPTFLL NDSNYYDGNG  180
GVLNNPQASR AFDSLSYFEF QPGFESSAYN SDLVAAQYHR TNIRPYESSS NFGFTSMPSL  240
ANSDHGSMSG TDFSDNSASR LGSFFMNEVK ESSSNSSNVG SYTAGCHMSS NNVIENAAFP  300
WETDNKLDSL FQFHFNGIKS EEIIKPNSSW QQQGQLVHHH AQNSVDFISY PLTSLSEDLT  360
GANFDVFQNI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362950.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5WFB80.0M5WFB8_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.17e-83myb domain protein 86